Primary Antibodies

View as table Download

Rabbit polyclonal OCT6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human OCT6.

Rabbit Polyclonal Anti-POU3F1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-POU3F1 Antibody: synthetic peptide directed towards the N terminal of human POU3F1. Synthetic peptide located within the following region: YLPRGPGGGAGGTGPLMHPDAAAAAAAAAERLHAGAAYREVQKLMHHEWL

Rabbit Polyclonal Anti-Pou3f1 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pou3f1 Antibody is: synthetic peptide directed towards the C-terminal region of Rat Pou3f1. Synthetic peptide located within the following region: CPKPSAHEITGLADSLQLEKEVVRVWFCNRRQKEKRMTPAAGAGHPPMDD

POU3F1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human POU3F1.