Primary Antibodies

Jump to Filters
View as table Download
Synpr Rabbit Polyclonal Antibody
TA309246

USD 415.00

5 Days

Rabbit Anti-synaptophysin 2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the C-terminal region conjugated to KLH
Synpr Rabbit Polyclonal Antibody
TA323830

USD 345.00

4 Weeks

Anti-Synpr Rabbit Polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.257~261(G-P-T-S-F)derived from Rat synaptophysin 2.
SYNPR Rabbit Polyclonal Antibody
TA342623

USD 375.00

5 Days

Rabbit Polyclonal Anti-SYNPR Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
SYNPR Rabbit Polyclonal Antibody
TA382248

USD 220.00

3 Weeks

SYNPR Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 196-265 of human SYNPR (NP_653243.1).
Modifications Unmodified