SYNPR Rabbit Polyclonal Antibody

CAT#: TA342623

Rabbit Polyclonal Anti-SYNPR Antibody

Product Images

WB Suggested Anti-Synpr Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Mouse Lung

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Synpr antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LVGDSSSSAEFFVTVAVFAFLYSLAATVVYIFFQNKYRENNRGPLIDFIV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 31 kDa
• Gene Name: synaptoporin
• Database Link:
  NP_001123475
  Entrez Gene 72003 Mouse
  UniProt ID Q8TBG9
• Background: Synpr is the intrinsic membrane protein of small synaptic vesicles. Synpr is a probable vesicular channel protein.
• Synonyms: SPO
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Secreted Protein, Transmembrane