Goat Polyclonal Antibody against VPS45 (C-terminal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ESSQVTSRSASRR, from the C Terminus of the protein sequence according to NP_009190.2. |
Goat Polyclonal Antibody against VPS45 (C-terminal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-ESSQVTSRSASRR, from the C Terminus of the protein sequence according to NP_009190.2. |
Goat Polyclonal Antibody against VPS45 (Internal region)
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-FQKKKPKEQQKLES, from the internal region of the protein sequence according to NP_009190.2. |
Rabbit Polyclonal Anti-Vps45 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Vps45 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH |
Rabbit Polyclonal Anti-Vps45 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Vps45 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vps45. Synthetic peptide located within the following region: PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT |