Primary Antibodies

View as table Download

Mouse monoclonal Hsp70/Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus
Conjugation Unconjugated

Mouse Monoclonal anti-Hsc70 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Rabbit Polyclonal anti-CALR Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep
Conjugation Unconjugated
Immunogen Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH

Mouse Monoclonal anti-Hsc70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast
Conjugation Unconjugated

Mouse monoclonal Hsp70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly
Conjugation Unconjugated

Mouse monoclonal Hsp70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly
Conjugation Unconjugated

Mouse monoclonal Hsp70 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly
Conjugation Unconjugated

Rabbit Polyclonal Anti-HSPA1L Antibody

Applications WB
Reactivities Human, Lamprey, Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD