Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70/Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Bovine, C.elegans, Beluga, Canine, Chicken, Drosophila, Fish, Guinea pig, Hamster, Monkey, Pig, Plant, Rabbit, Sheep, Xenopus |
Conjugation | Unconjugated |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Rabbit Polyclonal anti-CALR Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat, Bovine, Dog, Chicken, Drosophila, Fish, Guinea Porcine, Hamster, Monkey, Porcine, Rabbit, Sheep |
Conjugation | Unconjugated |
Immunogen | Human calreticulin synthetic peptide with a cysteine residue added and the peptide conjugated to KLH |
Mouse Monoclonal anti-Hsc70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Sheep, Dog, Beluga, Bovine, Fish, Guinea porcine, Scallop porcine, Hamster, Rabbit, Chicken, Xenopus, Drosophila, Yeast |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Mouse monoclonal Hsp70 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Amphibian, Chicken, Fish, Saccharomyces cerevisiae, Fruit Fly |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-HSPA1L Antibody
Applications | WB |
Reactivities | Human, Lamprey, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD |