HSPA1L Rabbit Polyclonal Antibody

CAT#: TA335710

Rabbit Polyclonal Anti-HSPA1L Antibody

Product Images

WB Suggested Anti-HSPA1L Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate

• 

  Sample Type: 1. Lamprey CNS (20ug); 2. Rat Brain Lysate (20ug); Primary Dilution: 1: 1000; Secondary Antibody: Goat anti-Rabbit HRP; Secondary Dilution: 1: 4000; Image Submitted by: Jennifer Morgan, PhD & David Busch; University of Texas in Austin

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Lamprey, Rat
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HSPA1L Antibody: synthetic peptide directed towards the C terminal of human HSPA1L. Synthetic peptide located within the following region: DEFDHKRKELEQMCNPIITKLYQGGCTGPACGTGYVPGRPATGPTIEEVD
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 70 kDa
• Gene Name: heat shock protein family A (Hsp70) member 1 like
• Database Link:
  NP_005518
  Entrez Gene 24963 RatEntrez Gene 3305 Human
  UniProt ID P34931
• Background: HSPA1L is a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. This gene encodes a 70kDa heat shock protein. In conjunction with other heat shock proteins, this protein stabilizes existing proteins against aggregation and mediates the folding of newly translated proteins in the cytosol and in organelles. The gene is located in the major histocompatibility complex class III region, in a cluster with two closely related genes which also encode isoforms of the 70kDa heat shock protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: HSP70-1L; HSP70-HOM; HSP70T; hum70t
• Note: Immunogen Sequence Homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Goat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Pathways: Antigen processing and presentation, Endocytosis, MAPK signaling pathway, Spliceosome