Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the middle region of human MCM4. Synthetic peptide located within the following region: VYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYE

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the N terminal of human MCM4. Synthetic peptide located within the following region: SRVEGTPRSGVRGTPVRQRPDLGSAQKGLQVDLQSDGAAAEDIVASEQSL

Rabbit Polyclonal Anti-MCM4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MCM4 antibody: synthetic peptide directed towards the C terminal of human MCM4. Synthetic peptide located within the following region: KEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRAL

Anti-MCM4 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 837-850 amino acids of Human minichromosome maintenance complex component 4