Primary Antibodies

Jump to Filters
View as table Download
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA314043

USD 345.00

In Stock

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
AP20472PU-N

USD 407.00

2 Weeks

5HT4 Receptor (HTR4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA314044

USD 345.00

4 Weeks

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.
5HT4 Receptor (HTR4) (N-term) Rabbit Polyclonal Antibody
AP52130PU-N

USD 450.00

2 Weeks

5HT4 Receptor (HTR4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human Serotonin receptor 4 (HTR4).
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA330423

USD 375.00

5 Days

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA
5HT4 Receptor (HTR4) Rabbit Polyclonal Antibody
TA323344

USD 345.00

In Stock

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled