FABP3 mouse monoclonal antibody, clone 22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 22
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 30
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
FABP3 mouse monoclonal antibody, clone 31
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the N terminal of human FABP3. Synthetic peptide located within the following region: NGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHL |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: MTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIV |
Rabbit Polyclonal Anti-FABP3 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-FABP3 antibody: synthetic peptide directed towards the middle region of human FABP3. Synthetic peptide located within the following region: DETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHG |
FABP3 (N-term) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human FABP3 |
Mouse monoclonal FAPB3 Antibody(Ascites)
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |