Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
GABARAP rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal GABARAP Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | N-terminus of GABAa Receptor Associated Protein (Proprietary) |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV |
Rabbit Polyclonal Anti-GABARAP
| Applications | WB |
| Reactivities | Human, Manducasexta |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL |
GABARAP Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human GABARAP |
Active filters
Target Symbol
- GABARAP
Applications
- WB
Pathways
- Regulation of autophagy