Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-AGXT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-AGXT2 antibody: synthetic peptide directed towards the N terminal of human AGXT2. Synthetic peptide located within the following region: TSVTKLSLHTKPRMPPCDFMPERYQSLGYNRVLEIHKEHLSPVVTAYFQK

AGXT2 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 443~473 amino acids from the C-terminal region of human AGXT2