Primary Antibodies

View as table Download

Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434
Modifications Phospho-specific

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1. Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT

Anti-GABRB1 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide sequence around aa.432~436 (R-A-S-Q-L) derived from Human GABRB1.

Rabbit Polyclonal anti-GABRB1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the middle region of human GABRB1. Synthetic peptide located within the following region: VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWV

Rabbit Polyclonal Anti-GABRB1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GABRB1

GABRB1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human GABRB1

GABA A Receptor beta 1 (GABRB1) Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human GABA A Receptor beta 1 (GABA A Receptor beta 1 (GABRB1))