GABA A Receptor beta 1 (GABRB1) Rabbit Polyclonal Antibody

CAT#: TA329170

Rabbit Polyclonal anti-GABRB1 antibody

Product Images

WB Suggested Anti-GABRB1 Antibody; Titration: 1.0 ug/ml; Positive Control: RPMI-8226 Whole Cell

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the middle region of human GABRB1. Synthetic peptide located within the following region: VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 51 kDa
• Gene Name: gamma-aminobutyric acid type A receptor beta1 subunit
• Database Link:
  NP_000803
  Entrez Gene 2560 Human
  UniProt ID P18505
• Background: GABA, the major inhibitory neurotransmitter in the vertebrate brain, mediates neuronal inhibition by binding to the GABA/benzodiazepine receptor and opening an integral chloride channel.
• Synonyms: beta 1; gamma-aminobutyric acid (GABA) A receptor
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%

Reference Data

• Protein Families: Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane
• Protein Pathways: Neuroactive ligand-receptor interaction