Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal GABA-RB (Ser434) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB around the phosphorylation site of Serine 434 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GABA-RB Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GABA-RB |
Rabbit Polyclonal Anti-GABRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the N terminal of human GABRB1. Synthetic peptide located within the following region: TLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRIT |
Anti-GABRB1 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around aa.432~436 (R-A-S-Q-L) derived from Human GABRB1. |
USD 410.00
5 Days
Mouse Monoclonal Anti-GABA(A) Receptor beta1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal anti-GABRB1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GABRB1 antibody: synthetic peptide directed towards the middle region of human GABRB1. Synthetic peptide located within the following region: VDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWV |
GABRB1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of Human GABRB1 |
GABA A Receptor beta 1 (GABRB1) Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human GABA A Receptor beta 1 (GABA A Receptor beta 1 (GABRB1)) |
Active filters
Target Symbol
- GABRB1