Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-HIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the C terminal of human HIC2. Synthetic peptide located within the following region: FACDECGMRFTRQYRLTEHMRVHSGEKPYECQLCGGKFTQQRNLISHLRM

Rabbit Polyclonal Anti-HIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the N terminal of human HIC2. Synthetic peptide located within the following region: MVSGPLALRWCAWAGRGDMGPDMELPSHSKQLLLQLNQQRTKGFLCDVII

Rabbit Polyclonal anti-HIC2 antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC

Goat Anti-HIC2 (aa188-200) Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-PQELPQAKGSDDE, from the internal region of the protein sequence according to NP_055909.2.

Rabbit Polyclonal Anti-HIC2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-HIC2 Antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: KSPPLPPATPGPHLTPDDAAQLSDSQHGSPPAASAPPVANSASYSELGGT

HIC2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 120-420 of human HIC2 (NP_055909.2).
Modifications Unmodified