HIC2 Rabbit Polyclonal Antibody

CAT#: TA331967

Rabbit Polyclonal Anti-HIC2 Antibody

Product Images

WB Suggested Anti-HIC2 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: Human brain

• 

  Host: Rabbit; Target Name: HIC2; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-HIC2 Antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: KSPPLPPATPGPHLTPDDAAQLSDSQHGSPPAASAPPVANSASYSELGGT
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 66 kDa
• Gene Name: hypermethylated in cancer 2
• Database Link:
  NP_055909
  Entrez Gene 23119 Human
  UniProt ID Q96JB3
• Background: HIC2 belongs to the krueppel C2H2-type zinc-finger protein family.
• Synonyms: HRG22; ZBTB30; ZNF907
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 93%; Dog: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Pig: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors