Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human LAIR1

Goat Anti-LAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-NDTEDVSQASPSE, from the internal region of the protein sequence according to NP_002278.1; NP_068352.1.

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the C-terminal region of Human LAIR1. Synthetic peptide located within the following region: LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL

Rabbit Polyclonal Anti-LAIR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the middle region of Human LAIR1. Synthetic peptide located within the following region: GNAGPYRCIYYKPPKWSEQSDYLELLVKGPTQRPSDNSHNEHAPASQGLK

LAIR1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAIR1

LAIR1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human LAIR1
Modifications Unmodified