LAIR1 Rabbit Polyclonal Antibody

CAT#: TA338009

Rabbit Polyclonal Anti-LAIR1 Antibody

Product Images

WB Suggested Anti-LAIR1 Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the C-terminal region of Human LAIR1. Synthetic peptide located within the following region: LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 27 kDa
• Gene Name: leukocyte associated immunoglobulin like receptor 1
• Database Link:
  NP_068352
  Entrez Gene 3903 Human
  UniProt ID Q6GTX8
• Background: The protein encoded by this gene is an inhibitory receptor found on peripheral mononuclear cells, including NK cells, T cells, and B cells. Inhibitory receptors regulate the immune response to prevent lysis of cells recognized as self. The gene is a member of both the immunoglobulin superfamily and the leukocyte-associated inhibitory receptor family. The gene maps to a region of 19q13.4 called the leukocyte receptor cluster, which contains at least 29 genes encoding leukocyte-expressed receptors of the immunoglobulin superfamily.
• Synonyms: CD305; LAIR-1
• Note: Immunogen Sequence Homology: Human: 100%

Reference Data

• Protein Families: Transmembrane