Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Hamster Anti-Mouse CD305 (LAIR-1) Purified (100 ug)
| Applications | FC |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
Goat Anti-LAIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NDTEDVSQASPSE, from the internal region of the protein sequence according to NP_002278.1; NP_068352.1. |
Rabbit Polyclonal Anti-LAIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the C-terminal region of Human LAIR1. Synthetic peptide located within the following region: LLVLFCLHRQNQIKQGPPRSKDEEQKPQQRPDLAVDVLERTADKATVNGL |
Rabbit Polyclonal Anti-LAIR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LAIR1 antibody is: synthetic peptide directed towards the middle region of Human LAIR1. Synthetic peptide located within the following region: GNAGPYRCIYYKPPKWSEQSDYLELLVKGPTQRPSDNSHNEHAPASQGLK |
LAIR1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human LAIR1 |
LAIR1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human LAIR1 |
| Modifications | Unmodified |
Active filters
Target Symbol
- LAIR1