Primary Antibodies

Jump to Filters
View as table Download
MS4A4A Rabbit Polyclonal Antibody
TA344314

USD 475.00

2 Weeks

Rabbit Polyclonal Anti-MS4A4A Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MS4A4A antibody: synthetic peptide directed towards the N terminal of human MS4A4A. Synthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL