Rabbit Polyclonal OLFM4 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody. |
Rabbit Polyclonal OLFM4 Antibody
Applications | IHC, WB |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids between 400 and 450 of human OLFM4 was used as immunogen for this antibody. |
Rabbit Polyclonal Anti-OLFM4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Rabbit Polyclonal Anti-OLFM4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OLFM4 |
OLFM4 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human OLFM4 |
OLFM4 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 211-510 of human OLFM4 (NP_006409.3). |
Modifications | Unmodified |