OLFM4 Rabbit Polyclonal Antibody
Other products for "OLFM4"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-OLFM4 antibody: synthetic peptide directed towards the C terminal of human OLFM4. Synthetic peptide located within the following region: EEIFYYYDTNTGKEGKLDIVMHKMQEKVQSINYNPFDQKLYVYNDGYLLN |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 55 kDa |
Gene Name | olfactomedin 4 |
Database Link | |
Background | OLFM4 is a member of the olfactomedin-related protein family. The exact function of its gene has not yet been determined.This gene was originally cloned from human myeloblasts and found to be selectively expressed in inflammed colonic epithelium. The protein encoded is a member of the olfactomedin-related protein family. The exact function of this gene has not yet been determined. |
Synonyms | bA209J19.1; GC1; GW112; hGC-1; hOLfD; OlfD; OLM4; UNQ362 |
Note | Immunogen Sequence Homology: Human: 100%; Pig: 86%; Rat: 86%; Horse: 86%; Bovine: 86%; Guinea pig: 86%; Dog: 79%; Rabbit: 79% |
Reference Data | |
Protein Families | Druggable Genome |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.