Primary Antibodies

View as table Download

Rabbit anti-TBXAS1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TBXAS1

Rabbit polyclonal anti-THAS antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human THAS.

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: GYEIITNTLSFATYLLATNPDCQEKLLREVDVFKEKHMAPEFCSLEEGLP

Rabbit Polyclonal Anti-TBXAS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TBXAS1 antibody is: synthetic peptide directed towards the C-terminal region of Human TBXAS1. Synthetic peptide located within the following region: LDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEIV

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) TBXAS1 mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Thromboxane synthase Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 355-534 of human Thromboxane synthase (NP_001052.2).
Modifications Unmodified

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H9 (formerly 1H9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)

Applications FC, IF, IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1B8 (formerly 1B8)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), Biotinylated

Applications FC, IF, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12), HRP conjugated

Applications FC, IF, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A12 (formerly 1A12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1A9 (formerly 1A9)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Biotin

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation HRP

Anti-TBXAS1 (Thromboxane synthase) mouse monoclonal antibody, clone OTI1H1 (formerly 1H1)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated