Primary Antibodies

View as table Download

Rabbit polyclonal APG1 (ULK1) Antibody (Center)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1).

Rabbit Polyclonal ULK1 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 .

Rabbit Polyclonal ULK1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN.

Rabbit Polyclonal Anti-ULK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL

ULK1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ULK1

ULK1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 400-499 of human ULK1 (NP_003556.1).
Modifications Unmodified

Phospho-ULK1-S757 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S757 of human Phospho-ULK1-S757 (NP_003556.1).
Modifications Phospho S757

Phospho-ULK1-S555 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S555 of human Phospho-ULK1-S555 (NP_003556.1).
Modifications Phospho S555

Phospho-ULK1-S638 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S638 of human Phospho-ULK1-S638.
Modifications Phospho S638

Phospho-ULK1-S467 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding S467 of human ULK1
Modifications Phospho S467

ULK1/ULK2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human ULK1/ULK2.