Primary Antibodies

Jump to Filters
View as table Download
VPS45A (VPS45) Goat Polyclonal Antibody
TA302901

USD 375.00

5 Days

Goat Polyclonal Antibody against VPS45 (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-ESSQVTSRSASRR, from the C Terminus of the protein sequence according to NP_009190.2.
VPS45A (VPS45) Goat Polyclonal Antibody
TA303041

USD 375.00

5 Days

Goat Polyclonal Antibody against VPS45 (Internal region)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-FQKKKPKEQQKLES, from the internal region of the protein sequence according to NP_009190.2.
Vps45 Rabbit Polyclonal Antibody
TA340170

USD 375.00

5 Days

Rabbit Polyclonal Anti-Vps45 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Vps45 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: VEYGGKRVRGSDLFSPKDAVAITKQFLKGLKGVENVYTQHQPFLHETLDH
Vps45 Rabbit Polyclonal Antibody
TA340171

USD 375.00

5 Days

Rabbit Polyclonal Anti-Vps45 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Vps45 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Vps45. Synthetic peptide located within the following region: PFLHETLDHLIKGRLKENLYPYLGPSTLRDRPQDIIVFIIGGATYEEALT