Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GP1BA antibody: synthetic peptide directed towards the C terminal of human GP1BA. Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS

Rabbit Polyclonal Anti-GP1BA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA

GP1BA Antibody

Applications WB
Conjugation Unconjugated