CD42b (GP1BA) Rabbit Polyclonal Antibody

CAT#: TA339190

Rabbit Polyclonal Anti-GP1BA


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GP1BA"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Protein A purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38 kDa
Gene Name glycoprotein Ib platelet alpha subunit
Background The function of this protein remains unknown.
Synonyms BDPLT1; BDPLT3; BSS; CD42B; CD42b-alpha; DBPLT3; GP1B; GPIbA; GPIbalpha; VWDP
Note Immunogen Sequence Homology: Human: 100%; Pig: 86%; Guinea pig: 86%; Rat: 79%
Reference Data
Protein Families Druggable Genome, Transmembrane
Protein Pathways ECM-receptor interaction, Hematopoietic cell lineage

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.