Primary Antibodies

View as table Download

Rabbit polyclonal SIRT3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from C-terminal of human SIRT3.

Rabbit Polyclonal Anti-SIRT3 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT3 antibody: A synthesized peptide derived from human SIRT3

Rabbit Polyclonal Anti-SIRT3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP

Rabbit Polyclonal Anti-SIRT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the middle region of human SIRT3. Synthetic peptide located within the following region: SGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYP

Goat Polyclonal Antibody against SIRT3

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QRETGKLDGPDK, from the C Terminus of the protein sequence according to NP_036371.1, NP_001017524.1.

Chicken Polyclonal SIRT3 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen SIRT3 antibody was raised against a 17 amino acid synthetic peptide near the center of human SIRT3. The immunogen is located within amino acids 180 - 230 of SIRT3.

Rabbit Polyclonal Anti-SIRT3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP

Anti-SIRT3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 126-382 amino acids of human sirtuin 3

SIRT3 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the N-terminal region of Human SIR3

SIRT3 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 20-130 of human SIRT3 (NP_036371.1).

SIRT3 Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 300 to the C-terminus of human SIRT3 (NP_036371.1).
Modifications Unmodified