SIRT3 Rabbit Polyclonal Antibody

CAT#: TA330279

Rabbit Polyclonal Anti-SIRT3 Antibody

Product Images

WB Suggested Anti-SIRT3 Antibody; Titration: 5 ug/ml; Positive Control: Fetal thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SIRT3 antibody: synthetic peptide directed towards the C terminal of human SIRT3. Synthetic peptide located within the following region: VGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 44 kDa
• Gene Name: sirtuin 3
• Database Link:
  NP_036371
  Entrez Gene 23410 Human
  UniProt ID Q9NTG7
• Background: SIRT3 is included in class I of the sirtuin family which is characterized by a sirtuin core domain. Human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity.
• Synonyms: SIR2L3
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Rabbit: 100%; Horse: 86%; Mouse: 86%; Dog: 79%; Pig: 79%; Rat: 79%; Guinea pig: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors