Primary Antibodies

View as table Download

Goat Polyclonal Antibody against SMUG1

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PQAFLLGSIHEPA-C, from the N Terminus of the protein sequence according to NP_055126.

Rabbit polyclonal anti-SMUG1 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human SMUG1.

Rabbit Polyclonal Anti-SMUG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMUG1 antibody: synthetic peptide directed towards the middle region of human SMUG1. Synthetic peptide located within the following region: IVGPVLTPPQEHPKRPVLGLECPQSEVSGARFWGFFRNLCGQPEVFFHHC

Carrier-free (BSA/glycerol-free) SMUG1 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) SMUG1 mouse monoclonal antibody,clone OTI6B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMUG1 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human SMUG1 (NP_055126.1).
Modifications Unmodified

SMUG1 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMUG1 mouse monoclonal antibody,clone OTI5G1, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SMUG1 mouse monoclonal antibody,clone OTI5G1, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SMUG1 mouse monoclonal antibody,clone OTI5G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMUG1 mouse monoclonal antibody,clone OTI6B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

SMUG1 mouse monoclonal antibody,clone OTI6B3, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin

SMUG1 mouse monoclonal antibody,clone OTI6B3, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP

SMUG1 mouse monoclonal antibody,clone OTI6B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit polyclonal anti-SMUG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMUG1

Rabbit polyclonal anti-SMUG1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMUG1