Primary Antibodies

View as table Download

Rabbit Polyclonal antibody to Centaurin alpha 1 (ArfGAP with dual PH domains 1)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 312 and 374 of Centaurin alpha 1 (Uniprot ID#O75689)

Goat Polyclonal Antibody against CENTA1

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-QEYAVEAHFKHKP, from the C Terminus of the protein sequence according to NP_006860.

Rabbit Polyclonal Anti-Adap1 Antibody

Applications WB
Reactivities Mouse
Immunogen The immunogen for anti-Centa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM

Anti-ADAP1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 3-376 amino acids of human Arf-GAP with dual PH domain-containing protein 1

Anti-ADAP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

ADAP1 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-374 of human ADAP1 (NP_006860.1).
Modifications Unmodified