Adap1 Rabbit Polyclonal Antibody

CAT#: TA340145

Rabbit Polyclonal Anti-Adap1 Antibody

Product Images

WB Suggested Anti-Centa1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Mouse Kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Centa1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: ARFHYLQVAFPGASDADLVPKLSRNYLKEGYMEKTGPKQTEGFRKRWFTM
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 33 kDa
• Gene Name: ArfGAP with dual PH domains 1
• Database Link:
  NP_766311
  Entrez Gene 231821 Mouse
• Background: The function of this protein remains unknown.
• Synonyms: CENTA1; centaurin-alpha; Centaurin-alpha-1; GCS1L; p42IP4
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 93%; Guinea pig: 93%