Rabbit Polyclonal Anti-TERF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TERF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TERF2. |
Rabbit Polyclonal Anti-TERF2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TERF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TERF2. |
Rabbit anti-TAF9 Polyclonal Antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TAF9 |
Rabbit Polyclonal Anti-KAD6 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KAD6 Antibody: A synthesized peptide derived from human KAD6 |
Rabbit Polyclonal Anti-TAF9 Antibody
Applications | Assay, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD |
Rabbit polyclonal TAF9 Antibody (N-term)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This TAF9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TAF9. |
Rabbit polyclonal anti-TAF9 / KAD6 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KAD6. |
AK6 rabbit polyclonal antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human AK6 |