Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-TERF2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TERF2 antibody was raised against a 17 amino acid peptide near the amino terminus of human TERF2.

Rabbit anti-TAF9 Polyclonal Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TAF9

Rabbit Polyclonal Anti-KAD6 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-KAD6 Antibody: A synthesized peptide derived from human KAD6

Rabbit Polyclonal Anti-TAF9 Antibody

Applications Assay, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-TAF9 Antibody: synthetic peptide directed towards the N terminal of human TAF9. Synthetic peptide located within the following region: GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVD

Rabbit polyclonal TAF9 Antibody (N-term)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This TAF9 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human TAF9.

Rabbit polyclonal anti-TAF9 / KAD6 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human KAD6.

AK6 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human AK6