Rabbit Polyclonal CAD Antibody
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | CAD antibody was raised against a peptide corresponding to amino acids 314 to 329 of murine CAD . |
Rabbit Polyclonal CAD Antibody
Applications | IF, IHC, WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | CAD antibody was raised against a peptide corresponding to amino acids 314 to 329 of murine CAD . |
Rabbit Polyclonal CAD Antibody
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CAD antibody was raised against a peptide corresponding to 17 amino acids near the center of murine CAD . |
DFFB (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1~30 amino acids from the N-terminal region of Human DFFB / CAD. |
Rabbit Polyclonal DFF40 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DFF40 antibody was raised against a peptide corresponding to 18 amino acids near the center of murine CAD. The immunogen is located within amino acids 130 - 180 of DFF40. |
Rabbit Polyclonal DFF40 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DFF40 antibody was raised against a peptide corresponding to amino acids 3 to 18 of human DFF40. |
Rabbit Polyclonal DFF40 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DFF40 antibody was raised against a peptide corresponding to amino acids 203 to 218 of human DFF40 . |
Rabbit Polyclonal Anti-DFFB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DFFB antibody: synthetic peptide directed towards the middle region of human DFFB. Synthetic peptide located within the following region: EYFYGLLFTSENLKLVHIVCHKKTTHKLNCDPSRIYKPQTRLKRKQPVRK |
DFFB Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human DFFB |
DFFB Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 109-338 of human DFFB (NP_004393.1). |
Modifications | Unmodified |