Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-DNA2L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DNA2L antibody: synthetic peptide directed towards the middle region of human DNA2L. Synthetic peptide located within the following region: KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTE

DNA2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of Human DNA2