Primary Antibodies

View as table Download

Rabbit polyclonal EN2 Antibody (C-term)

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This EN2 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 243-271 amino acids from the C-terminal region of human EN2.

Rabbit Polyclonal anti-EN2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-EN2 antibody is: synthetic peptide directed towards the C-terminal region of Human EN2. Synthetic peptide located within the following region: NESQIKIWFQNKRAKIKKATGNKNTLAVHLMAQGLYNHSTTAKEGKSDSE

Goat Polyclonal Antibody against EN2

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-NHSTTAKEGKSDSE, from the C Terminus of the protein sequence according to NP_001418.2.

EN2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human EN2

EN2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of Human EN2.
Modifications Unmodified