Primary Antibodies

Jump to Filters
View as table Download
KCNN2 Goat Polyclonal Antibody
AP10032PU-N

USD 375.00

5 Days

KCNN2 goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Immunogen Peptide with sequence from the Internal region of the protein sequence according to NP_067627.2; NP_740721.1.
Kcnn2 Rabbit Polyclonal Antibody
TA328940

USD 585.00

3 Weeks

Rabbit polyclonal Anti-KCa2.2 (SK2)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)ETQMENYDKHVTYNAERS, corresponding to amino acid residues 542-559 of rat KCa2.2. Intracellular, C-terminal part.
KCNN2 Rabbit Polyclonal Antibody
TA338526

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications IHC, WB
Reactivities Human, Rat, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the C terminal of human KCNN2. Synthetic peptide located within the following region: IDHAKVRKHQRKFLQAIHQLRSVKMEQRKLNDQANTLVDLAKTQNIMYDM
KCNN2 Rabbit Polyclonal Antibody
TA338745

USD 375.00

5 Days

Rabbit Polyclonal Anti-KCNN2 Antibody

Applications WB
Reactivities Human, Rhesus macaque
Conjugation Unconjugated
Immunogen The immunogen for anti-KCNN2 antibody: synthetic peptide directed towards the middle region of human KCNN2. Synthetic peptide located within the following region: KNAAANVLRETWLIYKNTKLVKKIDHAKVRKHQRKFLQAIHQLRSVKMEQ
Kcnn2 Rabbit Polyclonal Antibody
TA363259

USD 360.00

5 Days

KCNN2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse KCNN2
KCNN2 Rabbit Polyclonal Antibody
TA368610

USD 380.00

4 Weeks

KCNN2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human KCNN2