Primary Antibodies

View as table Download

Rabbit polyclonal Anti-PRIM2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS

PRIM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PRIM2 (NP_000938.2).
Modifications Unmodified

PRIM2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-170 of human PRIM2 (NP_000938.2).
Modifications Unmodified