DNA Primase (PRIM2) Rabbit Polyclonal Antibody

CAT#: TA331030

Rabbit polyclonal Anti-PRIM2 Antibody

Product Images

WB Suggested Anti-PRIM2 Antibody Titration: 5.0ug/ml; Positive Control: HepG2 cell lysate; There is BioGPS gene expression data showing that PRIM2 is expressed in HepG2

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 37 kDa
• Gene Name: primase (DNA) subunit 2
• Database Link:
  NP_000938
  Entrez Gene 5558 Human
  UniProt ID P49643
• Background: The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication.
• Synonyms: p58; PRIM2A
• Note: Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79%

Reference Data

• Protein Pathways: DNA replication, Metabolic pathways, Purine metabolism, Pyrimidine metabolism