DNA Primase (PRIM2) Rabbit Polyclonal Antibody
Other products for "PRIM2"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PRIM2 antibody: synthetic peptide directed towards the middle region of human PRIM2. Synthetic peptide located within the following region: QDFLKDSQLQFEAISDEEKTLREQEIVASSPSLSGLKLGFKSIYKPPFAS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 37 kDa |
Gene Name | primase (DNA) subunit 2 |
Database Link | |
Background | The replication of DNA in eukaryotic cells is carried out by a complex chromosomal replication apparatus, in which DNA polymerase alpha and primase are two key enzymatic components. Primase, which is a heterodimer of a small subunit and a large subunit, synthesizes small RNA primers for the Okazaki fragments made during discontinuous DNA replication. |
Synonyms | p58; PRIM2A |
Note | Human: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Dog: 86%; Horse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 79% |
Reference Data | |
Protein Pathways | DNA replication, Metabolic pathways, Purine metabolism, Pyrimidine metabolism |
Documents
Product Manuals |
FAQs |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.