Rabbit Polyclonal BAFF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF. |
Rabbit Polyclonal BAFF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | BAFF antibody was raised against a peptide corresponding to amino acids near the carboxy terminus of human BAFF. |
Rabbit anti-TNFSF13B Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human TNFSF13B |
Rabbit Polyclonal Anti-TNFSF13B Antibody - N-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Anti-Human BAFF Goat Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human BAFF |
Rabbit Polyclonal BAFF/BLyS/TNFSF13B Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This rabbit polyclonal antibody was developed against a C-terminal peptide corresponding to amino acids 254-269 of human TNFSF13B. |
Carrier-free (BSA/glycerol-free) TNFSF13B mouse monoclonal antibody, clone OTI7F12 (formerly 7F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
TNFSF13B Antibody - middlel region
Applications | WB |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse TNFSF13B |
Recombinant Anti-CD257 (BAFF) (Clone Tabalumab)
Applications | ELISA, FC, IF, IP, Neutralize, WB |
Reactivities | Human, Monkey, Rabbit |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Human IgG4 format, for improved compatibility with existing reagents, assays and techniques. |
TNFSF13B mouse monoclonal antibody, clone OTI7F12 (formerly 7F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
TNFSF13B mouse monoclonal antibody, clone OTI7F12 (formerly 7F12), Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
TNFSF13B mouse monoclonal antibody, clone OTI7F12 (formerly 7F12), HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
TNFSF13B mouse monoclonal antibody, clone OTI7F12 (formerly 7F12)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |