BAFF (TNFSF13B) Rabbit Polyclonal Antibody
Frequently bought together (3)
Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1
USD 439.00
Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 13b (TNFSF13B), transcript variant 1
USD 396.00
Other products for "TNFSF13B"
Specifications
Product Data | |
Applications | WB |
Recommended Dilution | WB |
Reactivities | Human |
Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TNFSF13B antibody: synthetic peptide directed towards the N terminal of human TNFSF13B. Synthetic peptide located within the following region: ALQGDLASLRAELQGHHAEKLPAGAGAPKAGLEEAPAVTAGLKIFEPPAP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Predicted Protein Size | 31 kDa |
Gene Name | tumor necrosis factor superfamily member 13b |
Database Link | |
Background | The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for receptors TNFRSF13B/TACI, TNFRSF17/BCMA, and TNFRSF13C/BAFFR. This cytokine is expressed in B cell lineage cells, a |
Synonyms | BAFF; BLYS; CD257; DTL; TALL-1; TALL1; THANK; TNFSF20; ZTNF4 |
Note | Immunogen Sequence Homology: Human: 100%; Horse: 83% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
Product Manuals |
FAQs |
SDS |
{0} Product Review(s)
0 Product Review(s)
Submit review
Be the first one to submit a review
Product Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.