Primary Antibodies

Jump to Filters
View as table Download
Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody
TA324533

USD 450.00

5 Days

Rabbit polyclonal UBP1 Antibody (Center)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This UBP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 266-295 amino acids from the Central region of human UBP1.
Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody
TA333869

USD 375.00

5 Days

Rabbit Polyclonal Anti-UBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-UBP1 Antibody: synthetic peptide directed towards the middle region of human UBP1. Synthetic peptide located within the following region: GASQTSGEQIQPSATIQETQQWLLKNRFSSYTRLFSNFSGADLLKLTKED
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI6C7]
CF808808

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody, clone OTI6C7 (formerly 6C7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI7D3]
CF808809

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody, clone OTI7D3 (formerly 7D3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI9C7]
CF808815

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody,clone OTI9C7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI1C9]
CF808816

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody, clone OTI1C9 (formerly 1C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI1G8]
CF808821

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody, clone OTI1G8

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI9B3]
CF808852

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody,clone OTI9B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Mouse Monoclonal Antibody [Clone ID: OTI8F1]
CF808853

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) UBP1 mouse monoclonal antibody, clone OTI8F1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Upstream Binding Protein 1 (UBP1) Rabbit Polyclonal Antibody
TA351346

USD 345.00

In Stock

Rabbit Polyclonal Anti-UBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBP1
UBP1 Rabbit Polyclonal Antibody
TA367120

USD 380.00

4 Weeks

UBP1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human UBP1