Primary Antibodies

View as table Download

Mouse Monoclonal Anti-VISTA Antibody [4C4]

Applications ELISA, FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-C10orf54 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7E9

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI7A6D5

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) C10orf54 mouse monoclonal antibody,clone OTI1D10C1

Applications WB
Reactivities Human
Conjugation Unconjugated