GI24 (C10orf54) Rabbit Polyclonal Antibody

CAT#: TA338488

Rabbit Polyclonal Anti-C10orf54 Antibody

Product Images

WB Suggested Anti-C10orf54 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 62500; Positive Control: NCI-H226 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C10orf54 antibody: synthetic peptide directed towards the N terminal of human C10orf54. Synthetic peptide located within the following region: TWYRSSRGEVQTCSERRPIRNLTFQDLHLHHGGHQAANTSHDLAQRHGLE
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: chromosome 10 open reading frame 54
• Database Link:
  NP_071436
  Entrez Gene 64115 Human
  UniProt ID Q9H7M9
• Background: The function of this protein remains unknown.
• Synonyms: B7-H5; B7H5; GI24; PP2135; SISP1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 92%; Dog: 86%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane