Germany
Japan
United Kingdom
China
Rabbit Anti-NMDA NR2C Subunit Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein from the N-terminal region of the NR2C subunit |
Primary Antibodies
View as table Download
Rabbit polyclonal NMDAR2B (Tyr1336) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR2B around the phosphorylation site of tyrosine 1336 (S-P-YP-A-H). |
| Modifications | Phospho-specific |
Rabbit polyclonal GR (Ab-226) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GR around the phosphorylation site of serine 226/234/246 (L-L-S-P-L). |
Rabbit polyclonal GR (Ser226) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human GR around the phosphorylation site of serine 226 (L-L-SP-P-L). |
| Modifications | Phospho-specific |
USD 345.00
In Stock
Rabbit polyclonal anti-CHRM4 antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CHRM4. |
USD 345.00
In Stock
USD 345.00
In Stock
Rabbit polyclonal anti-GLRB antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GLRB. |
Rabbit polyclonal anti-KITH_VZV7 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human KITH_VZV7. |
CALCRL / CRLR Rabbit Polyclonal (Cytoplasmic Domain) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Bovine, Dog, Xenopus, Gorilla, Goat, Hamster, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | CALCRL / CGRP Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human CALCRL. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rat, Goat, Hamster, Panda, Dog, Bovine, Horse, Rabbit, Pig, Opossum, Xenopus (100%); Mouse, Elephant, Bat, Guinea pig, Stickleback, Pufferfish, Zebrafish (94%); Turkey, Chicken (81%). |
NPBWR2 / GPR8 Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | NPBWR2 / GPR8 antibody was raised against synthetic 17 amino acid peptide from N-terminal extracellular domain of human NPBWR2. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (94%); Gibbon (88%). |
LGR7 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human, Orang-Utan |
| Conjugation | Unconjugated |
| Immunogen | RXFP1/ LGR7 antibody was raised against synthetic 19 amino acid peptide from C-terminus of human RXFP1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan (100%); Gibbon, Monkey (95%); Marmoset (84%). |
EDG1 / S1P1 Rabbit Polyclonal (aa25-40) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | S1PR1 / EDG1 / S1P1 antibody was raised against synthetic peptide from human S1PR1 / EDG1. |
NMDAR1 / NR1 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | GRIN1 / NMDAR1 antibody was raised against synthetic peptide from human NMDAR1 (aa864-913). |
Goat polyclonal Plasminogen antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Plasminogen [Human Plasma] |
Rabbit polyclonal NMDAR1 (Phospho-Ser890) antibody
| Applications | IF, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human NMDAR1 around the phosphorylation site of serine 890 (A-S-SP-F-K). |
| Modifications | Phospho-specific |
Goat Anti-GLP1R Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-QHQWDGLLSYQD, from the internal region of the protein sequence according to NP_002053.3. |
Rabbit Polyclonal Anti-ADRB1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV |
Goat Anti-GRIA4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KKLDQREYPGSETP, from the internal region of the protein sequence according to NP_000820.3; NP_001070711.1; NP_001070712.1. |
Rabbit anti-ADRA1D polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide conjugated to KLH |
Rabbit polyclonal anti-GNRHR antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GNRHR. |
| Modifications | Phospho-specific |
Rabbit polyclonal anti-HCRTR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human HCRTR1. |
Rabbit polyclonal anti-P2RY13 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human P2RY13. |
Rabbit polyclonal anti-GALR3 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GALR3. |
Rabbit polyclonal anti-PTGER3 antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PTGER3. |
Rabbit polyclonal Histamine H1 Receptor (Ser398)(Phospho-specific)
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human Histamine H1 Receptor around the phosphorylation site of serine 398 (IS-H-SP-R-Q). |
| Modifications | Phospho-specific |
Rabbit polyclonal GRIN2B(Ab-1303) antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human GRIN2B around the phosphorylation site of serine 1303 (Q-H-SP-Y-D). |
Rabbit polyclonal anti-CCKAR antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCKAR. |
Rabbit polyclonal anti-ADRA1B antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRA1B. |
Active filters
Clonalities
- Polyclonal
Pathways
- Neuroactive ligand-receptor interaction
Availabilities
- In Stock
Filter by
Category
Target Symbol
- NR3C1 (13)
- GRIN2B (9)
- F2R (5)
- GRIN1 (5)
- GRM3 (5)
- BDKRB1 (4)
- GLRA1 (4)
- LPAR3 (4)
- PTGER2 (4)
- S1PR1 (4)
- ADRA2A (3)
- ADRB2 (3)
- ADRB3 (3)
- APLNR (3)
- CHRM1 (3)
- EDNRA (3)
- GABRB1 (3)
- GRIK1 (3)
- GRIN2C (3)
- GRM4 (3)
- HCRTR1 (3)
- HRH1 (3)
- LEP (3)
- LPAR4 (3)
- MAS1 (3)
- MC1R (3)
- OPRD1 (3)
- PLG (3)
- PRL (3)
- SSTR2 (3)
- SSTR4 (3)
- ADRA1A (2)
- AGTR1 (2)
- BRS3 (2)
- CALCRL (2)
- CCKAR (2)
- CHRM2 (2)
- CRHR2 (2)
- CSH1 (2)
- EDNRB (2)
- F2 (2)
- FPR2 (2)
- FPR3 (2)
- GABBR1 (2)
- GCGR (2)
- GHR (2)
- GHSR (2)
- GIPR (2)
- GLP1R (2)
- GNRHR (2)
- GRIA2 (2)
- GRIA3 (2)
- GRIN2A (2)
- GRM7 (2)
- GRM8 (2)
- GRPR (2)
- HCRTR2 (2)
- HRH2 (2)
- HTR2C (2)
- HTR4 (2)
- KISS1R (2)
- LPAR2 (2)
- MC2R (2)
- MC4R (2)
- MC5R (2)
- MLNR (2)
- MTNR1A (2)
- OPRL1 (2)
- P2RY2 (2)
- P2RY4 (2)
- PRLR (2)
- PTGER1 (2)
- PTGER3 (2)
- SCTR (2)
- SSTR1 (2)
- SSTR3 (2)
- TRPV1 (2)
- VIPR1 (2)
- ADORA1 (1)
- ADRA1B (1)
- ADRA1D (1)
- ADRB1 (1)
- AVPR2 (1)
- BDKRB2 (1)
- C3AR1 (1)
- CALCR (1)
- CCKBR (1)
- CGA (1)
- CHRM3 (1)
- CHRM4 (1)
- CHRM5 (1)
- CNR1 (1)
- CRHR1 (1)
- CTSG (1)
- CYSLTR1 (1)
- CYSLTR2 (1)
- DRD1 (1)
- DRD5 (1)
- F2RL2 (1)
- F2RL3 (1)
Reactivities
Applications
Antibody Hosts
Isotypes
Conjugates
Modifications
Families
- Druggable Genome (285)
- Transmembrane (249)
- GPCR (186)
- Ion Channels: Glutamate Receptors (32)
- Secreted Protein (17)
- Transcription Factors (16)
- Nuclear Hormone Receptor (14)
- Ion Channels: Cys-loop Receptors (10)
- ES Cell Differentiation/IPS (6)
- Protease (6)
- Ion Channels: Sodium (2)
- Ion Channels: Transient receptor potential (2)
- Ion Channels: ATP Receptors (1)