beta 1 Adrenergic Receptor (ADRB1) Rabbit Polyclonal Antibody

CAT#: TA329147

Rabbit Polyclonal Anti-ADRB1 Antibody

Product Images

Host: Rabbit; Target Name: ADRB1; Sample Tissue: THP-1 Whole Cell lysates; Antibody Dilution: 3.0ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-ADRB1 antibody is: synthetic peptide directed towards the C-terminal region of Human ADRB1. Synthetic peptide located within the following region: SDDDDDDVVGATPPARLLEPWAGCNGGAAADSDSSLDEPCRPGFASESKV
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 52 kDa
• Gene Name: adrenoceptor beta 1
• Database Link:
  NP_000675
  Entrez Gene 153 Human
  UniProt ID P08588
• Background: ADRB1 is a beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. It mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling.
• Synonyms: ADRB1R; B1AR; BETA1AR; RHR
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 91%

Reference Data

• Protein Families: Druggable Genome, GPCR, Transmembrane
• Protein Pathways: Calcium signaling pathway, Dilated cardiomyopathy, Endocytosis, Gap junction, Neuroactive ligand-receptor interaction