Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: EEFDELCFEFGLELDEITSEKEIISKEQGNVKAAGASDVVLYKIDVPANR

Rabbit Polyclonal Anti-FARSB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-FARSB Antibody is: synthetic peptide directed towards the N-terminal region of Human FARSB. Synthetic peptide located within the following region: HDLDTLSGPFTYTAKRPSDIKFKPLNKTKEYTACELMNIYKTDNHLKHYL

Rabbit Polyclonal Anti-FARSB Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

FARSB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human FARSB

FARSB Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 240-589 of human FARSB (NP_005678.3).
Modifications Unmodified