Primary Antibodies

View as table Download

Rabbit polyclonal anti-HTR4 antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human HTR4.

5HT4 Receptor (HTR4) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit polyclonal anti-5-HT-4 antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human 5-HT-4.

Rabbit Polyclonal 5HT4 Receptor Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to an C-terminal portion of the human 5HT4 Receptor protein (between residues 350-400) [UniProt Q13639]

5HT4 Receptor (HTR4) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human Serotonin receptor 4 (HTR4).

Rabbit Polyclonal Anti-HTR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HTR4 antibody: synthetic peptide directed towards the middle region of human HTR4. Synthetic peptide located within the following region: GCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYA

Rabbit Polyclonal Anti-HTR4 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 17 amino acid peptide from C-terminus of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Hamster, Panda, Dog, Bat, Bovine, Horse, Rabbit, Guinea pig (100%); Marmoset, Elephant, Opossum, Turkey, Chicken, Platypus, Lizard (94%); Mouse, Rat (88%); Pig (82%).

Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 15 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Dog, Bat, Bovine, Rabbit, Horse, Pig (100%); Mouse, Rat, Hamster (93%); Guinea pig, Platypus (87%); Lizard (80%).

Rabbit Polyclonal Anti-HTR4 Antibody (C-Terminus)

Applications IHC
Reactivities Human
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 20 amino acid peptide from C-terminus of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Horse, Pig (100%); Panda, Dog, Rabbit (95%); Bat, Bovine (90%); Guinea pig (85%); Mouse, Rat (80%).

Rabbit Polyclonal Anti-HTR4 Antibody (Cytoplasmic Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen HTR4 / 5-HT4 Receptor antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human 5HT4 Receptor. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat (94%); Marmoset, Hamster, Elephant, Panda, Dog, Horse, Pig, Guinea pig (88%); Bat, Rabbit (81%).

Anti-5HT4 Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 45-59 amino acids of Human 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled

HTR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human HTR4.
Modifications Unmodified