Rabbit Polyclonal Anti-PCBP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCBP1 antibody is: synthetic peptide directed towards the middle region of Human PCBP1. Synthetic peptide located within the following region: PHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAMMHGGTGF |
Rabbit Polyclonal Anti-PCBP1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCBP1 antibody: synthetic peptide directed towards the middle region of human PCBP1. Synthetic peptide located within the following region: CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM |
Goat Anti-PCBP1 (aa223-234) Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SIQGQHTISPLD, from the internal region of the protein sequence according to NP_006187.2. |
Goat Anti-PCBP1 (aa234-247) Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-ADLAKLNQVARQQSH, from the internal region of the protein sequence according to CAA55016.1. |
hnRNP E1/PCBP1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human hnRNP E1/hnRNP E1/PCBP1 (NP_006187.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
