Primary Antibodies

View as table Download

PFKFB4 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFKFB4

Rabbit polyclonal Anti-PFKFB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PFKFB4 antibody: synthetic peptide directed towards the N terminal of human PFKFB4. Synthetic peptide located within the following region: MASPRELTQNPLKKIWMPYSNGRPALHACQRGVCMTNCPTLIVMVGLPAR

Pfkfb4 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

PFKFB4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human PFKFB4